RISK IDENT is a young and fast-growing software development company based in Hamburg, Germany. Founded in 2012, our team became one of the market leaders within fraud prevention in the German speaking market in a very short period of time. Today, RISK IDENT has a strong customer base, the majority of our customers coming from e-commerce, telecommunications and financial services. We secure more than 50 billion euros of annual turnover against fraud for our customers. We are an established start-up with an innovative SaaS business model. We have an excellent market position and are financially backed. Today, our team consists of around 70 people at our HQ in Hamburg, with every single one of them loving what they do. We are always on the lookout for new challenges and for smart people to accompany us along the way! Today, our team consists of around 50 people at our HQ in Hamburg, with every single one of them loving what they do. We are always on the lookout for new challenges and for smart people to accompany us along the way! We Offer Flexible remote work guideline with emphasis on team alignment Access to an online learning platform Free choice between Lenovo ThinkPad T-Series and 16" Apple MacBook, and free choice of IDE Public transport & lunch allowance Regular workout sessions at no charge (shower in the office) Attractive discounts at various partner shops and gyms Relocation support: constant contact person, issuing documents, help with public offices, translation support, etc.

scalanode.jsjavascriptangularlinuxdockerakkacloudscalazkuberneteskafkaansiblerxjsfunctional programming

Wayfair is the destination for all things home and a place that helps everyone, anywhere, create their feeling of home. We are a truly global company and THE leader in all things home and e-commerce - we've come a long way since day 1 but as we see it, this is just the start of our journey! Fast Facts Founded in 2002 Active Customers +20M Products +18M Suppliers +12,000 Net Revenue 2019 $9.1B Employees 16,900 All of this success and growth would never have been possible without Wayfair's biggest assets, that being our fantastic people and the culture that our colleagues bring to the table. Wayfair Culture Overview Analytical by nature Strong sense of vision and purpose Collaborative Open culture Meetings take place in open areas and are inclusive, efficient and valuable Flat hierarchy Customer focused Low ego but very ambitious Move fast, and learn from mistakes Wayfair is setting its sights on some extremely ambitious (but attainable!) goals for the future and with this ambition comes the opportunity for you to grow with us into what will most definitely be an exciting journey!

javajavascriptreactdockerdocker swarmgoogle cloudhelmci/cdkubernetesrest apisgithubjava 8reduxcode quality

PRODA is a PropTech start-up founded in January 2017. We focus on solving core data processing pain points in real estate, and believe that unstructured data is a key barrier to digital transformation in the industry. PRODA is combining real estate expertise with data science to develop machine leaning-enabled software, with the aim of truly automating many analysis and reporting tasks for real estate professionals. Our software automatically captures property data from spreadsheets, before standardising, error-checking & securely storing it. This enables users to standardise and access all their data, regardless of the country, asset class or company that it originated from. Once standardised, many exciting machine-learning analyses, track changes and machine written reports are possible. Based in a smart We-work in London's Southbank PRODA has: Modern, open office with communal areas, quite spaces, table games, unlimited teas and coffees and beers in the evenings Focus on getting in specialists, encouraging meetups, conferences, training and learning for software engineers Regular team meals and activities Culture of smart individuals who collaborate to solve interesting problems using interesting technologies

scalahaskellelmjavascriptreacthtmldockergoogle cloudcode reviewscss3intellijnixterraformtypescript

Truecaller was born in 2009, Stockholm, Sweden, with the mission to provide more safe and efficient communication to everyone’s daily life. Today, Truecaller is loved by 200 million daily active users around the world, popular in South Asia, Middle East, Africa! We are the go-to app for Caller ID, spam blocking and payments. Truecaller is a Swedish company founded in 2009 in Stockholm, Sweden by Nami Zarringhalam and Alan Mamedi. The app began when our co-founders were just students who wanted to create a service that would easily identify incoming calls from unknown numbers. We have our strongest presence in South Asia, Middle East, Africa, and HQ in Sweden. We are backed by some of the most prominent investors in the world such as Sequoia Capital, Atomico, and Kleiner Perkins Caufield & Byers.

scalapythonjavajavascriptlinuxdistributed systemsci/cdkubernetesgolangjvmsparkbig dataflexible workingpension

Travel with the people you love. Group travel has never been this easy - check out our homes and locations across the country. Collectively, we’ve traveled to over 80 countries and know what matters most - creating an authentic experience. We believe the best travel accommodations are all about delivering an exceptional, unique stay and far too often property managers and hosts fall short on delivering a first-class short-term rental experience. AvantStay is here to change that by setting the new standard for short-term rental experiences. Our team is incredibly passionate about real estate, technology and the arts. We came together to build a revolutionary hospitality brand through the power of virtual tech automation in the short-term rental market. With offices in San Francisco and Los Angeles, we currently operate in 7 markets across the United States. Our proprietary tech algorithm and data experts identify partnership opportunities and automate operations through our virtual management system to maximize efficiencies and improve the overall guest experience.

scalareactkinesisaws lambdamonixpostgresqlcode qualitycode reviewsslackreact nativeg-suitecatsgitlabremote working

Premium tech recruitment & software development agency specializing in challenging projects - mobile apps, websites, Back-End, Front-End, Big Data, Data Analytics, graphic design. Extensive vetting process of the candidates. Super high clients' satisfaction rate. Google-level engineers.

elmf#pythonjavac#rubynode.jsc++javascriptangularreacthtmlcssandroid

Founded in 2015, IO Global is one of the world’s pre-eminent blockchain research and engineering companies, best known for the Cardano blockchain platform. We are a fully decentralized, remote-working organization committed to the highest principles of academic rigour and evidence-based software development. The company builds high-assurance blockchain products for public and private sector clients. Our goal is simple – to fuel our drive to be best in class by giving you the opportunity, resources and support to deliver your finest work to date. You’ll work with some exceptionally talented and friendly individuals who are always open to new ideas and ways of working. IO Global is an advocate of decentralized remote working, with 300 people working in more than 50 countries. Everyone has a different skill set, a different culture, and is at a different stage in their life. We aim to make collaboration between diverse people fun, exciting, and always rewarding. Many companies say they ‘think outside the box’ – for IO Global it’s more, ‘we think outside the geography’.

scalahaskellrustjavascriptreactbddsolidityblockchaintdddistributedslackjiranixopsnix

Gartner Digital Markets is a business unit within Gartner. Our mission is to help small businesses make the right technology decisions and find the tools they need to grow, optimize, and become more effective at what they do. The business is comprised of three leading brands—Capterra, Software Advice, and GetApp. For candidates interested in taking their next career step in the technology space, Gartner Digital Markets offers the fast pace and excitement of working for a startup, the stability and resources of a large, established organization, and the opportunity to be on the front lines of innovation in an industry that is always growing and transforming.

elixirdockerelasticsearchkuberneteskafkapostgresqlawsremote workingflexible workinghealth insurancepaid sick daysgym passespension contributionsdiverse management team

Ethyca builds automated data privacy infrastructure and tools for developers and privacy teams to easily build products that comply with GDPR, CCPA Privacy Regulations. Ethyca's powerful and flexible automated data privacy and protection tools provide any business with a future-proof solution to compliance with privacy regulations across global jurisdictions. Whether you're simply collecting consumer email addresses or inferring complex data points from unlimited data points, Ethyca provides your product, engineering and privacy teams with unmatched ease of use and functionality to better care about your user's data. We believe that user privacy matters more now than ever and that the solution to managing user data is not in regulation but in code. We are a passionate and excited team of problem-solvers (that also happen to be music lovers, exercise enthusiasts, PC and console gamers, and wine aficionados). We not only love solving challenges for our customers, but also thinking about the current and future state of data privacy in society. At its core, Ethyca is engineering company. We're building a missing component of the internet's infrastructure - privacy-respecting data systems. If you're as stimulated about this mission as we are, we'd love to talk to you.

scalapythonjavaangularreactgoogle cloudci/cdkuberneteskafkaterraformawsjenkinsazureflexible working

Zalando is Europe’s leading online platform for fashion, connecting customers, brands and partners across 17 markets. We drive digital solutions for fashion, logistics, advertising and research, bringing head-to-toe fashion to more than 23 million active customers through diverse skill-sets, interests and languages our teams choose to use. 🌍. IT ALL STARTED WITH A SHOE... 👠...in a shared apartment/office/warehouse on Berlin’s trendy Torstrasse. Well, a few pairs of shoes actually. Since then we’ve sold a lot more shoes and have grown to be Europe’s largest online fashion retailer or you may call us Europe's most fashionable tech department. Today, we offer fashion-lovers in 15 different countries our wide range of products – from High Street favourites to designer brands, sportswear and kidswear for him and her. A lot has changed since then, but our core values have always remained the same – combining great fashion with the latest technology and exceptional customer service. A PROUD COMMUNITY Over the years, we have built a strong community. We love to share our passions, insights and expertise for technologies and topics we love through 100+ self-organised guilds, internal tech talks, training initiatives, demos, local meet-up events, conferences and more. In addition to encouraging an engaged community, we support you in building your reputation as tech leader - not only among your peers at Zalando but industry-wide. We know that every new technology and methodology we implement involves a learning curve, so our teams are dedicated to help everyone get up to speed on using the tools they need to work successfully. OPEN SOURCE 📢 We're passionate about collaboration and giving back to the community. Check out our open source projects to learn more about the technologies we are contributing to and building. (https://github.com/zalando)

scalaclojurehaskellpythonjavanode.jsjavascriptreactandroidlinuxdockercontinuous deploymentcontinuous integrationcloud

We are an international venture builder based in Africa and Europe, we love helping corporates and entrepreneurs bring their ambitions to life. Our goal is to build a system that can validate, build and launch 100 quality ventures a year.

pythonc#reacthtmlcssandroidlinuxdockeramazon s3ci/cdaws lambdagithubslackcirclecl

Metabase is the easy, open source way for everyone in your company to ask questions and learn from data. Key features of the product: 5 minute setup Let anyone on your team ask questions without knowing SQL Rich beautiful dashboards with auto refresh and fullscreen SQL Mode for analysts and data pros Create canonical segments and metrics for your team to use Send data to Slack or email on a schedule with dashboard subscriptions View data in Slack anytime with MetaBot Humanize data for your team by renaming, annotating and hiding fields See changes in your data with alerts

clojureclojurescriptjavascriptreactcssgithubsentryterraformcircleciremote workinghealth insuranceseries btechnology

We're building a better financial world. Over the past ten years, we have built a machine learning and technology platform that is revolutionising how small businesses access finance. Business owners can complete a loan application and receive a decision in a matter of minutes, enabling them to get funding quickly at an affordable rate. Today, as the leading global provider for small business loans we have helped more than 100,000 small businesses access more than £11.5 billion in finance. Funding Circle is the largest online small business loans provider and one of the best-capitalised lending platforms in the world. The business is listed on the London Stock Exchange (Ticker: FCH). Our backers collectively manage over $5 trillion and are the leading firms behind Facebook, Twitter, Skype and Betfair. Build the incredible, with us!!

clojurejavarubyjavascriptreacthtmlcsslinuxdockerci/cdgithubcode qualitycode reviewstdd

Axoni is a New York-based technology firm that specializes in multiparty workflows and infrastructure. Founded in 2013 by a team of distributed systems and capital markets experts, the company offers core data infrastructure, application development, and automation tools. Axoni’s technology is used across global capital markets by the world’s leading banks, asset managers, hedge funds, and infrastructure providers.

scalapythonjavajavascriptreactakkadjangohealth insurancesocial eventswellness budgetpaid time offeducational opportunitiesprivatetechnology

H-E-B Digital is a little different than the average tech company. Like most corporate success stories, ours has a humble beginning, but it doesn’t start in a garage or with an algorithm. Instead, the H-E-B story starts with an ill husband, a determined wife, and three children to feed. Armed with just $60 and her wits, in 1905 our founder, Mrs. Florence Butt, opened a grocery store in her home and set in motion a generation-spanning commitment to feed not just her own children, but everyone in her state. 100+ years, 400+ stores, 5 different brands, one international expansion, and a few billion dollars in charitable contributions later, we’re getting closer to meeting that goal, but there’s still so much work to do. That’s where you come in. The digital arm of a brick and mortar institution, H-E-B Digital is tasked with providing solutions at scale for every part of the business. We create digital products for the millions of households that shop at H-E-B, but also for the 120,000+ employees who serve those households alongside us, from the teenager working their first job to the classically trained chef. But we don’t stop at the store: Our support spans from the farmers that grow our food to the drivers and warehouse workers that bring that food to the stores to the business functions that develop, source, package and sell that food, to the teams that give back to the community with the profits that food brings in. Our teams of engineers and analysts, designers and researchers, eCommerce experts and managers of all stripes are assembled and ready to tackle the hardest tech and digital problems. All we’re missing is you.

scalaclojurehaskellhealth insurance401kgenerous ptoflexible spending accountprivateretail

Powernoodle is the most powerful, yet easy to use, Decision Engagement Platform that helps leaders make better quality decisions by quickly and effectively engaging the collective wisdom of stakeholders. Cloud technology is fused with 50 years of cognitive, behavioral, and decision science to focus stakeholders, and minimize the biases, barriers and dysfunctions typical to most organizations that get in the way of making quality decisions. With Powernoodle’s extensive suite of capabilities, leaders can quickly and easily create structured decision activities that optimize stakeholder engagement and create the alignment needed to execute with confidence and outperform. Powered by science and fueled by people, Powernoodle is, quite simply, the better way to decide.

clojureclojurescriptjavascriptreactdockercloudghost inspectorrabbitmqslackamazon ec2awsmysqlnew relicamazon rds

scalahaskellreacttypestypescriptfp-ts

javascriptdockergcpelasticsearchkuberneteshtml5kafkabigquerybootstrapscsstypescriptbpmnmustache.jsprotractor

We are SCRUFF and Jack’d, two of the world’s largest gay, bi, trans and queer social dating apps on iOS and Android. Our brands reach more than 20 million members worldwide so members can connect, meet and express themselves on a platform that prioritizes privacy and security. Perry Street Software is deeply committed to protecting and defending the LGBTQ+ community, and this is manifest in every business decision we make. We never use or share data with third-party ad networks, choosing instead to manage all ad programs in-house. Perry Street is also involved in internet policy at a national level, and has engaged with Senators, Congresspeople and policymakers on Section 230 regulation to defend LBGTQ+ digital spaces. Learn more about this vision in videos from our co-founder and CEO.

javarubyswiftdockerkuberneteskotlinruby on railsawsiosremote workingflexible workinggym membershipsmedical insurance401k + match

LaunchDarkly is a Feature Management Platform that serves hundreds of billions of feature flags daily to help software teams build better software, faster. Feature flagging is an industry standard methodology of wrapping a new or risky section of code or infrastructure change with a flag. Each flag can easily be turned off independent of code deployment (aka "dark launching"). LaunchDarkly has SDKs for all major web and mobile platforms. We are building a diverse team so that we can offer robust products and services. Our team culture is dynamic, friendly, and supportive. Our headquarters are in Oakland.

pythonnode.jsjavascriptreactandroidgolangiosremote workingunlimited vacation policyfull healthcare coveragestock optionsseries ctechnology

We're a football analytics startup (both the soccer and American varieties!) We sell data products as well as analysis tools to sports organisations, with a tech stack that includes computer vision, machine learning, stream processing, and web-based dataviz. We're hiring devops engineers, and front-end, back-end or full-stack software engineers to build out product teams across our fast growing business. We count many of the biggest names in football as customers, and your work will have a direct impact on our ability to deliver insights to those customers, driving success on the field.

clojureclojurescriptpythonnode.jsjavascriptreactdeep learningcudakafkapostgresqlanalyticspytorchdata scienceaws

We believe that making the best possible use of the web is the way to turn useful data into valuable insights 🚀. Swirrl's PublishMyData software platform helps government organisations to make their data more accessible and re-usable, enabling better informed decisions. 🔎 Transforming how government finds data PublishMyData wraps your data in world-class search, browse and discovery technology. Users can explore by topic, map and natural language search. Specialists can also use details of vocabularies and classification schemes to filter data or use the full featured query language for the most precise or complex search requirements. 🧠 Transforming how government understands data PublishMyData helps you annotate, cross-reference and document your data, making it self-describing. All your users can rely on common clear, precise and consistent definitions of every term in your domain, allowing them to apply data with confidence. Datasets can be illuminated and enriched with explanatory notes and details of methodology. 🔌 Transforming how government connects data PublishMyData weaves your data into a graph, breaking it out of silos and joining it to other data from inside and outside your organisation to enable new connections and new comparisons. 📈 Transforming how government uses data PublishMyData makes your data ready to use anywhere: combine data sources to create custom spreadsheets on the desktop; syndicate the data into offline systems; power online apps and visualisations. 🎛 Transforming how government manages data PublishMyData puts you in control of your data. Edit, transform, load, validate and publish your data in teams, or automate and integrate the process into code workflows. Be confident that your publishing is timely, trustworthy and reliable.

clojureclojurescriptjavascriptreactgcpawsgraphqlremote workingflexible workinglaptopequipment budget30 days annual leave + bank holidaysprivatetechnology